PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G232200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 373aa    MW: 39453.4 Da    PI: 4.8372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G232200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161663148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  Sevir.7G232200.1.p 16 KGSWTPEEDMRLIAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                        799*****************************99************97 PP

2Myb_DNA-binding53.17.5e-1769114148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T+eE+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  Sevir.7G232200.1.p  69 RGNFTAEEEETIIKLHGLLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                         89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.1951163IPR017930Myb domain
SuperFamilySSF466892.1E-3013110IPR009057Homeodomain-like
SMARTSM007172.3E-131565IPR001005SANT/Myb domain
PfamPF002492.9E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-241770IPR009057Homeodomain-like
CDDcd001673.45E-111863No hitNo description
PROSITE profilePS5129424.82964118IPR017930Myb domain
SMARTSM007179.9E-1568116IPR001005SANT/Myb domain
PfamPF002495.7E-1569114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2671117IPR009057Homeodomain-like
CDDcd001672.04E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNKGSWT PEEDMRLIAY IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTAEEEETI IKLHGLLGNK WSKIAACLPG RTDNEIKNVW NTHLKKRVSP  120
GAEERGGAAG SKKKKKAAGA GVPAAAAPSP SPSSSTTTAT TNCSSGDSGE QQSKASKDEP  180
GDELGLEKLE IIPMLDDPAC FGFDMLVDQI PDPYCPDVSV PTSPCASSTS PPAPARPSVD  240
ELLDLPEIDI DHELWSIIDG VGGDGAGAGA VAAGTAPAPC QSNATEPNAA ASTTSHGTEW  300
WLEDLEKELG LWGPMEDYQY PMGPQCPVAH PDPLPAMVDD PVSCYFQAGP APAMLHEPGY  360
SSVVTSSNQM GY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-29141182105C-Myb DNA-Binding Domain
1msf_C3e-29141182105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114135KKRVSPGAEERGGAAGSKKKKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0701451e-174BT070145.1 Zea mays full-length cDNA clone ZM_BFc0138F01 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976660.10.0PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-109MYB1_MAIZE; Myb-related protein Zm1
TrEMBLK3Y8430.0K3Y843_SETIT; Uncharacterized protein
STRINGSi010384m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.17e-69myb domain protein 63